Lineage for d6swhd2 (6swh D:122-205)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382837Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2382838Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2382856Protein FimC [49588] (1 species)
  7. 2382857Species Escherichia coli [TaxId:562] [49589] (9 PDB entries)
  8. 2382863Domain d6swhd2: 6swh D:122-205 [391673]
    Other proteins in same PDB: d6swha1, d6swhb_, d6swhd1, d6swhe_
    automated match to d1bf8a2
    complexed with edo, peg

Details for d6swhd2

PDB Entry: 6swh (more details), 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli
PDB Compounds: (D:) chaperone protein fimc

SCOPe Domain Sequences for d6swhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6swhd2 b.7.2.1 (D:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d6swhd2:

Click to download the PDB-style file with coordinates for d6swhd2.
(The format of our PDB-style files is described here.)

Timeline for d6swhd2: