SCOPe 2.08: Domain d6swhd2: 6swh D:122-205

Lineage for d6swhd2 (6swh D:122-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)

8. Domain d6swhd2: 6swh D:122-205 [391673]
   Other proteins in same PDB: d6swha1, d6swhb_, d6swhc_, d6swhd1, d6swhe_, d6swhf_
   automated match to d1bf8a2
   complexed with edo, peg

Details for d6swhd2

PDB Entry: 6swh, 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli

PDB Compounds: (D:) chaperone protein fimc

SCOPe Domain Sequences for d6swhd2:

Sequence; same for both SEQRES and ATOM records:

>d6swhd2 b.7.2.1 (D:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d6swhd2:

• d6swhd2 first appeared in SCOPe 2.07