Lineage for d6swhd1 (6swh D:1-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374560Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2374578Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2374579Species Escherichia coli [TaxId:562] [49359] (9 PDB entries)
  8. 2374585Domain d6swhd1: 6swh D:1-121 [391672]
    Other proteins in same PDB: d6swha2, d6swhb_, d6swhd2, d6swhe_
    automated match to d1bf8a1
    complexed with edo, peg

Details for d6swhd1

PDB Entry: 6swh (more details), 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli
PDB Compounds: (D:) chaperone protein fimc

SCOPe Domain Sequences for d6swhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6swhd1 b.1.11.1 (D:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d6swhd1:

Click to download the PDB-style file with coordinates for d6swhd1.
(The format of our PDB-style files is described here.)

Timeline for d6swhd1: