![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
![]() | Protein Periplasmic chaperone FimC [49358] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49359] (11 PDB entries) |
![]() | Domain d6swhd1: 6swh D:1-121 [391672] Other proteins in same PDB: d6swha2, d6swhb_, d6swhc_, d6swhd2, d6swhe_, d6swhf_ automated match to d1bf8a1 complexed with edo, peg |
PDB Entry: 6swh (more details), 2.8 Å
SCOPe Domain Sequences for d6swhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6swhd1 b.1.11.1 (D:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d6swhd1: