SCOPe 2.08: Domain d6swhd1: 6swh D:1-121

Lineage for d6swhd1 (6swh D:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)

8. Domain d6swhd1: 6swh D:1-121 [391672]
   Other proteins in same PDB: d6swha2, d6swhb_, d6swhc_, d6swhd2, d6swhe_, d6swhf_
   automated match to d1bf8a1
   complexed with edo, peg

Details for d6swhd1

PDB Entry: 6swh, 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli

PDB Compounds: (D:) chaperone protein fimc

SCOPe Domain Sequences for d6swhd1:

Sequence; same for both SEQRES and ATOM records:

>d6swhd1 b.1.11.1 (D:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d6swhd1:

• d6swhd1 first appeared in SCOPe 2.07