Lineage for d2u2fa_ (2u2f A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412490Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species)
  7. 412491Species Human (Homo sapiens) [TaxId:9606] [54937] (4 PDB entries)
  8. 412494Domain d2u2fa_: 2u2f A: [39167]
    second RNA-binding domain

Details for d2u2fa_

PDB Entry: 2u2f (more details)

PDB Description: solution structure of the second rna-binding domain of hu2af65

SCOP Domain Sequences for d2u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)}
ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai
aglngmqlgdkkllvqrasvgakna

SCOP Domain Coordinates for d2u2fa_:

Click to download the PDB-style file with coordinates for d2u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2u2fa_: