Lineage for d2u2fa_ (2u2f A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80287Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 80377Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species)
  7. 80378Species Human (Homo sapiens) [TaxId:9606] [54937] (2 PDB entries)
  8. 80379Domain d2u2fa_: 2u2f A: [39167]

Details for d2u2fa_

PDB Entry: 2u2f (more details)

PDB Description: solution structure of the second rna-binding domain of hu2af65

SCOP Domain Sequences for d2u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)}
ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai
aglngmqlgdkkllvqrasvgakna

SCOP Domain Coordinates for d2u2fa_:

Click to download the PDB-style file with coordinates for d2u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2u2fa_: