Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (13 proteins) |
Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54937] (2 PDB entries) |
Domain d2u2fa_: 2u2f A: [39167] |
PDB Entry: 2u2f (more details)
SCOP Domain Sequences for d2u2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)} ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai aglngmqlgdkkllvqrasvgakna
Timeline for d2u2fa_: