SCOPe 2.07: Domain d6swla_: 6swl A:

Lineage for d6swla_ (6swl A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [391646] (1 PDB entry)

8. Domain d6swla_: 6swl A: [391662]
   automated match to d2vuib_
   complexed with mg, phd

Details for d6swla_

PDB Entry: 6swl, 2.17 Å

PDB Description: the rec domain of xync, a response regulator from geobacillus stearothermophilus

PDB Compounds: (A:) Two-component response regulator

SCOPe Domain Sequences for d6swla_:

Sequence; same for both SEQRES and ATOM records:

>d6swla_ c.23.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mhektilvvddepraregmkrllekwasgkhriitaangqealdilrqervhvlltdirm
peitgldvleemrekddspavilisaypdfdyaqkaislgvlnyllkpvkkselfeavek
aihvseqkererv

Timeline for d6swla_:

• d6swla_ is new in SCOPe 2.07-stable
  
• d6swla_ appears in the current release, SCOPe 2.08