SCOPe 2.08: Domain d6sw4a_: 6sw4 A:

Lineage for d6sw4a_ (6sw4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [369939] (4 PDB entries)

8. Domain d6sw4a_: 6sw4 A: [391657]
   automated match to d3g1wb_

Details for d6sw4a_

PDB Entry: 6sw4, 1.85 Å

PDB Description: the structure of arap, an arabinose binding protein from geobacillus stearothermophilus

PDB Compounds: (A:) Arabinose binding protein

SCOPe Domain Sequences for d6sw4a_:

Sequence; same for both SEQRES and ATOM records:

>d6sw4a_ c.93.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
pdekyvmvtfqsgmdywkrclkgfedaaeslnvsveyrgatqydvneqvtvleqviarkp
agiaisainptaltktinkaveegipvvlfdsnasgskafsflgtnnysagvtaahemak
llksegkvavitsphqlnhqertrgfvetiyqkyprmqvvavkngkgdalaskqaamevl
ndypdvqgifateanggvgmaeavaelnkkyvklisfdtekqtldlvkegaiaatlaqgt
wnmgywslqflfhlhhhltspsrsgdallpayvdtgitvvtrdnvdhfya

Timeline for d6sw4a_:

• d6sw4a_ first appeared in SCOPe 2.07