| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (8 species) not a true protein |
| Species Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId:437402] [391651] (1 PDB entry) |
| Domain d6sw8a1: 6sw8 A:2-73 [391652] Other proteins in same PDB: d6sw8a2, d6sw8b2 automated match to d2n74a_ complexed with edo, peg |
PDB Entry: 6sw8 (more details), 1.93 Å
SCOPe Domain Sequences for d6sw8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sw8a1 a.16.1.1 (A:2-73) automated matches {Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId: 437402]}
dsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrvatmeg
kkivedilkset
Timeline for d6sw8a1: