SCOP 1.69: Domain d2u1a__: 2u1a -

Lineage for d2u1a__ (2u1a -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (20 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries)

8. Domain d2u1a__: 2u1a - [39164]
   domain 2

Details for d2u1a__

PDB Entry: 2u1a

PDB Description: rna binding domain 2 of human u1a protein, nmr, 20 structures

SCOP Domain Sequences for d2u1a__:

Sequence; same for both SEQRES and ATOM records:

>d2u1a__ d.58.7.1 (-) Splicesomal U1A protein {Human (Homo sapiens)}
mapaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdne
vqagaardalqgfkitqnnamkisfakk

Timeline for d2u1a__:

• d2u1a__ first appeared (with stable ids) in SCOP 1.55
  
• d2u1a__ appears in SCOP 1.67
  
• d2u1a__ appears in SCOP 1.71
  
• d2u1a__ appears in the current release, SCOPe 2.08, called d2u1aa_