Lineage for d2u1a__ (2u1a -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257517Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 257518Species Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries)
  8. 257538Domain d2u1a__: 2u1a - [39164]
    domain 2
    mutant

Details for d2u1a__

PDB Entry: 2u1a (more details)

PDB Description: rna binding domain 2 of human u1a protein, nmr, 20 structures

SCOP Domain Sequences for d2u1a__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2u1a__ d.58.7.1 (-) Splicesomal U1A protein {Human (Homo sapiens)}
mapaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdne
vqagaardalqgfkitqnnamkisfakk

SCOP Domain Coordinates for d2u1a__:

Click to download the PDB-style file with coordinates for d2u1a__.
(The format of our PDB-style files is described here.)

Timeline for d2u1a__: