Lineage for d6slda2 (6sld A:95-310)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460484Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2460485Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2460521Family c.13.1.0: automated matches [227225] (1 protein)
    not a true family
  6. 2460522Protein automated matches [226966] (3 species)
    not a true protein
  7. 2460534Species Saccharomyces cerevisiae [TaxId:559292] [391634] (1 PDB entry)
  8. 2460535Domain d6slda2: 6sld A:95-310 [391635]
    Other proteins in same PDB: d6slda1
    automated match to d3b7na2
    complexed with b7n; mutant

Details for d6slda2

PDB Entry: 6sld (more details), 1.4 Å

PDB Description: structure of the phosphatidylcholine binding mutant of yeast sec14 homolog sfh1 (s175i,t177i) in complex with phosphatidylinositol
PDB Compounds: (A:) CRAL-TRIO domain-containing protein YKL091C

SCOPe Domain Sequences for d6slda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6slda2 c.13.1.0 (A:95-310) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylieticivldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts

SCOPe Domain Coordinates for d6slda2:

Click to download the PDB-style file with coordinates for d6slda2.
(The format of our PDB-style files is described here.)

Timeline for d6slda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6slda1