SCOPe 2.07: Domain d6slda2: 6sld A:95-310

Lineage for d6slda2 (6sld A:95-310)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.0: automated matches [227225] (1 protein)
   not a true family

6. Protein automated matches [226966] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [391634] (1 PDB entry)

8. Domain d6slda2: 6sld A:95-310 [391635]
   Other proteins in same PDB: d6slda1
   automated match to d3b7na2
   complexed with b7n; mutant

Details for d6slda2

PDB Entry: 6sld, 1.4 Å

PDB Description: structure of the phosphatidylcholine binding mutant of yeast sec14 homolog sfh1 (s175i,t177i) in complex with phosphatidylinositol

PDB Compounds: (A:) CRAL-TRIO domain-containing protein YKL091C

SCOPe Domain Sequences for d6slda2:

Sequence; same for both SEQRES and ATOM records:

>d6slda2 c.13.1.0 (A:95-310) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylieticivldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts

Timeline for d6slda2:

• d6slda2 is new in SCOPe 2.07-stable
  
• d6slda2 appears in the current release, SCOPe 2.08