Lineage for d6slda1 (6sld A:4-94)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309595Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 2309614Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 2309615Protein automated matches [226965] (4 species)
    not a true protein
  7. 2309640Species Saccharomyces cerevisiae [TaxId:559292] [350494] (2 PDB entries)
  8. 2309641Domain d6slda1: 6sld A:4-94 [391633]
    Other proteins in same PDB: d6slda2
    automated match to d3b7na1
    complexed with b7n; mutant

Details for d6slda1

PDB Entry: 6sld (more details), 1.4 Å

PDB Description: structure of the phosphatidylcholine binding mutant of yeast sec14 homolog sfh1 (s175i,t177i) in complex with phosphatidylinositol
PDB Compounds: (A:) CRAL-TRIO domain-containing protein YKL091C

SCOPe Domain Sequences for d6slda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6slda1 a.5.3.0 (A:4-94) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf
dinasvemfveterwreeygantiiedyenn

SCOPe Domain Coordinates for d6slda1:

Click to download the PDB-style file with coordinates for d6slda1.
(The format of our PDB-style files is described here.)

Timeline for d6slda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6slda2