SCOPe 2.08: Domain d6slda1: 6sld A:4-94

Lineage for d6slda1 (6sld A:4-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [350494] (2 PDB entries)

8. Domain d6slda1: 6sld A:4-94 [391633]
   Other proteins in same PDB: d6slda2
   automated match to d3b7na1
   complexed with b7n; mutant

Details for d6slda1

PDB Entry: 6sld, 1.4 Å

PDB Description: structure of the phosphatidylcholine binding mutant of yeast sec14 homolog sfh1 (s175i,t177i) in complex with phosphatidylinositol

PDB Compounds: (A:) CRAL-TRIO domain-containing protein YKL091C

SCOPe Domain Sequences for d6slda1:

Sequence; same for both SEQRES and ATOM records:

>d6slda1 a.5.3.0 (A:4-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf
dinasvemfveterwreeygantiiedyenn

Timeline for d6slda1:

• d6slda1 first appeared in SCOPe 2.07