![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
![]() | Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
![]() | Protein automated matches [226965] (4 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [350494] (2 PDB entries) |
![]() | Domain d6slda1: 6sld A:4-94 [391633] Other proteins in same PDB: d6slda2 automated match to d3b7na1 complexed with b7n; mutant |
PDB Entry: 6sld (more details), 1.4 Å
SCOPe Domain Sequences for d6slda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6slda1 a.5.3.0 (A:4-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf dinasvemfveterwreeygantiiedyenn
Timeline for d6slda1: