SCOPe 2.08: Domain d6sxia1: 6sxi A:6-112

Lineage for d6sxia1 (6sxi A:6-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6sxia1: 6sxi A:6-112 [391625]
   Other proteins in same PDB: d6sxia2, d6sxib_, d6sxil1, d6sxil2
   automated match to d1oauh_
   complexed with gol

Details for d6sxia1

PDB Entry: 6sxi, 1.85 Å

PDB Description: antibody-anti-idiotype complex: ap33 fab (hepatitis c virus e2 antibody) - b2.1a scfv (anti-idiotype)

PDB Compounds: (A:) Single chain Fv - heavy chain

SCOPe Domain Sequences for d6sxia1:

Sequence; same for both SEQRES and ATOM records:

>d6sxia1 b.1.1.1 (A:6-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgtelvkpgasvklsckasgytftnywmhwvkqrqglewigeinpsdghtnynekfksk
atltvdkssstaymqlssltsedsavyycarpwafgnygawfaywgqgtlvtvs

Timeline for d6sxia1:

• d6sxia1 first appeared in SCOPe 2.07