Lineage for d6svea1 (6sve A:6-39)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420693Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2420694Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2420695Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2420729Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 2420730Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries)
  8. 2420762Domain d6svea1: 6sve A:6-39 [391598]
    Other proteins in same PDB: d6svea2
    automated match to d1i6ca_

Details for d6svea1

PDB Entry: 6sve (more details)

PDB Description: protein allostery of the ww domain at atomic resolution: pcdc25c bound structure
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d6svea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6svea1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekrmsrnsgrvyyfnhitnasqferpsg

SCOPe Domain Coordinates for d6svea1:

Click to download the PDB-style file with coordinates for d6svea1.
(The format of our PDB-style files is described here.)

Timeline for d6svea1:

2420762
d6svea1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6svea2