Lineage for d1drza_ (1drz A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257517Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 257518Species Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries)
  8. 257531Domain d1drza_: 1drz A: [39159]
    domain 1, complex with a hepatitis delta virus ribozyme
    complexed with mg, so4; mutant

Details for d1drza_

PDB Entry: 1drz (more details), 2.3 Å

PDB Description: u1a spliceosomal protein/hepatitis delta virus genomic ribozyme complex

SCOP Domain Sequences for d1drza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drza_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOP Domain Coordinates for d1drza_:

Click to download the PDB-style file with coordinates for d1drza_.
(The format of our PDB-style files is described here.)

Timeline for d1drza_: