Lineage for d1drza_ (1drz A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) 
Family d.58.7.1: Canonical RBD [54929] (12 proteins) - Protein Splicesomal U1A protein [54932] (1 species)
- Species Human (Homo sapiens) [TaxId:9606] [54933] (8 PDB entries)
Domain d1drza_: 1drz A: [39159]
Details for d1drza_
PDB Entry: 1drz (more details), 2.3 Å
PDB Description: u1a spliceosomal protein/hepatitis delta virus genomic ribozyme complex
SCOP Domain Sequences for d1drza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1drza_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk
SCOP Domain Coordinates for d1drza_:
Click to download the PDB-style file with coordinates for d1drza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1drza_:
- d1drza_ appears in SCOP 1.57
- d1drza_ appears in the current release, SCOPe 2.08
View in 3D