Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Escherichia coli [TaxId:83333] [391536] (2 PDB entries) |
Domain d6smzb2: 6smz B:164-295 [391558] Other proteins in same PDB: d6smza1, d6smzb1, d6smzc1, d6smzd1 automated match to d3pdua2 complexed with nad |
PDB Entry: 6smz (more details), 1.75 Å
SCOPe Domain Sequences for d6smzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6smzb2 a.100.1.0 (B:164-295) automated matches {Escherichia coli [TaxId: 83333]} pgmgirvklinnymsialnalsaeaavlcealnlpfdvavkvmsgtaagkghfttswpnk vlsgdlspafmidlahkdlgialdvanqlhvpmplgaasrevysqaraagrgrqdwsail eqvrvsagmtak
Timeline for d6smzb2: