SCOPe 2.08: Domain d6smzb2: 6smz B:164-295

Lineage for d6smzb2 (6smz B:164-295)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [391536] (2 PDB entries)

8. Domain d6smzb2: 6smz B:164-295 [391558]
   Other proteins in same PDB: d6smza1, d6smzb1, d6smzc1, d6smzd1
   automated match to d3pdua2
   complexed with nad

Details for d6smzb2

PDB Entry: 6smz, 1.75 Å

PDB Description: crystal structure of sla reductase yihu from e. coli in complex with nadh

PDB Compounds: (B:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6smzb2:

Sequence; same for both SEQRES and ATOM records:

>d6smzb2 a.100.1.0 (B:164-295) automated matches {Escherichia coli [TaxId: 83333]}
pgmgirvklinnymsialnalsaeaavlcealnlpfdvavkvmsgtaagkghfttswpnk
vlsgdlspafmidlahkdlgialdvanqlhvpmplgaasrevysqaraagrgrqdwsail
eqvrvsagmtak

Timeline for d6smzb2:

• d6smzb2 first appeared in SCOPe 2.07