Lineage for d6stuc_ (6stu C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386520Species Human adenovirus 30 [TaxId:46932] [391549] (1 PDB entry)
  8. 2386523Domain d6stuc_: 6stu C: [391550]
    automated match to d1h7za_
    complexed with edo, glu

Details for d6stuc_

PDB Entry: 6stu (more details), 2.39 Å

PDB Description: adenovirus 30 fiber knob protein
PDB Compounds: (C:) Fiber

SCOPe Domain Sequences for d6stuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6stuc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 30 [TaxId: 46932]}
vgnknndkltlwttpdpspnckvseekdskltlvltkcgsqilasvsllvvkgkfaninn
etnpgedykkfsvkllfdangklltgssldgnywnyknkdsvigspyenavpfmpnstay
pkiinngtanpedkksaakktivtnvylggdagqpvattvsfnketesncvysitfdfaw
nktyknvpfdsssltfsyiaqdaedk

SCOPe Domain Coordinates for d6stuc_:

Click to download the PDB-style file with coordinates for d6stuc_.
(The format of our PDB-style files is described here.)

Timeline for d6stuc_: