SCOP 1.63: Domain d1urnc_: 1urn C:

Lineage for d1urnc_ (1urn C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (14 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries)

8. Domain d1urnc_: 1urn C: [39155]
   domain 1
   protein/RNA complex; complexed with cl, gol; mutant

Details for d1urnc_

PDB Entry: 1urn, 1.92 Å

PDB Description: u1a mutant/rna complex + glycerol

SCOP Domain Sequences for d1urnc_:

Sequence; same for both SEQRES and ATOM records:

>d1urnc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d1urnc_:

• d1urnc_ first appeared (with stable ids) in SCOP 1.55
  
• d1urnc_ appears in SCOP 1.61
  
• d1urnc_ appears in SCOP 1.65
  
• d1urnc_ appears in the current release, SCOPe 2.08