SCOPe 2.08: Domain d6smza1: 6smz A:2-163

Lineage for d6smza1 (6smz A:2-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [349042] (4 PDB entries)

8. Domain d6smza1: 6smz A:2-163 [391535]
   Other proteins in same PDB: d6smza2, d6smzb2, d6smzc2, d6smzd2
   automated match to d3pdua1
   complexed with nad

Details for d6smza1

PDB Entry: 6smz, 1.75 Å

PDB Description: crystal structure of sla reductase yihu from e. coli in complex with nadh

PDB Compounds: (A:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6smza1:

Sequence; same for both SEQRES and ATOM records:

>d6smza1 c.2.1.0 (A:2-163) automated matches {Escherichia coli [TaxId: 83333]}
aaiafiglgqmgspmasnllqqghqlrvfdvnaeavrhlvdkgatpaanpaqaakdaefi
itmlpngdlvrnvlfgengvceglstdalvidmstihplqtdkliadmqakgfsmmdvpv
grtsanaitgtllllaggtaeqveratpilmamgselinagg

Timeline for d6smza1:

• d6smza1 first appeared in SCOPe 2.07