Lineage for d6skta_ (6skt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420910Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (8 PDB entries)
  8. 2420914Domain d6skta_: 6skt A: [391532]
    automated match to d1v9ea_
    complexed with cu, e6b, gol, zn

Details for d6skta_

PDB Entry: 6skt (more details), 1.9 Å

PDB Description: crystal structure of bovine carbonic anhydrase ii in complex with a benzenesulfonamide-based ligand (sh0)
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d6skta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6skta_ b.74.1.1 (A:) Carbonic anhydrase {Cow (Bos taurus), isozyme II [TaxId: 9913]}
hhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnn
ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
wntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmla
nwrpaqplknrqvrgfpk

SCOPe Domain Coordinates for d6skta_:

Click to download the PDB-style file with coordinates for d6skta_.
(The format of our PDB-style files is described here.)

Timeline for d6skta_: