SCOPe 2.07: Domain d2up1a1: 2up1 A:8-98

Lineage for d2up1a1 (2up1 A:8-98)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 protein domains)
   Pfam PF00076
   Pfam PF13893

6. Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
   Uniprot P09651 7-188

8. Domain d2up1a1: 2up1 A:8-98 [39151]
   protein/DNA complex

Details for d2up1a1

PDB Entry: 2up1, 2.1 Å

PDB Description: structure of up1-telomeric dna complex

PDB Compounds: (A:) protein (heterogeneous nuclear ribonucleoprotein a1)

SCOPe Domain Sequences for d2up1a1:

Sequence; same for both SEQRES and ATOM records:

>d2up1a1 d.58.7.1 (A:8-98) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrp

Timeline for d2up1a1:

• d2up1a1 first appeared (with stable ids) in SCOP 1.55
  
• d2up1a1 appears in SCOPe 2.06