SCOPe 2.07: Domain d6s96a_: 6s96 A:

Lineage for d6s96a_ (6s96 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d6s96a_: 6s96 A: [391502]
   automated match to d1zdna1
   complexed with fmt, na

Details for d6s96a_

PDB Entry: 6s96, 2.18 Å

PDB Description: crystal structure of the catalytic domain of ube2s c118a.

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 S

SCOPe Domain Sequences for d6s96a_:

Sequence; same for both SEQRES and ATOM records:

>d6s96a_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllg
kdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikallihpnpes
alneeagrlllenyeeyaararllteihg

Timeline for d6s96a_:

• d6s96a_ is new in SCOPe 2.07-stable
  
• d6s96a_ appears in the current release, SCOPe 2.08