![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (12 proteins) |
![]() | Protein Nuclear ribonucleoprotein A1, RNP A1, UP1 [54930] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54931] (3 PDB entries) |
![]() | Domain d1up1_1: 1up1 7-92 [39149] |
PDB Entry: 1up1 (more details), 1.9 Å
SCOP Domain Sequences for d1up1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up1_1 d.58.7.1 (7-92) Nuclear ribonucleoprotein A1, RNP A1, UP1 {Human (Homo sapiens)} pkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatve evdaamnarphkvdgrvvepkravsr
Timeline for d1up1_1: