Lineage for d1up1_1 (1up1 7-92)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32659Protein Nuclear ribonucleoprotein A1, RNP A1, UP1 [54930] (1 species)
  7. 32660Species Human (Homo sapiens) [TaxId:9606] [54931] (3 PDB entries)
  8. 32663Domain d1up1_1: 1up1 7-92 [39149]

Details for d1up1_1

PDB Entry: 1up1 (more details), 1.9 Å

PDB Description: up1, the two rna-recognition motif domain of hnrnp a1

SCOP Domain Sequences for d1up1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up1_1 d.58.7.1 (7-92) Nuclear ribonucleoprotein A1, RNP A1, UP1 {Human (Homo sapiens)}
pkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatve
evdaamnarphkvdgrvvepkravsr

SCOP Domain Coordinates for d1up1_1:

Click to download the PDB-style file with coordinates for d1up1_1.
(The format of our PDB-style files is described here.)

Timeline for d1up1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1up1_2