![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) Uniprot P09651 7-188 |
![]() | Domain d1ha1a2: 1ha1 A:99-180 [39148] |
PDB Entry: 1ha1 (more details), 1.75 Å
SCOPe Domain Sequences for d1ha1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha1a2 d.58.7.1 (A:99-180) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} ahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsv dkiviqkyhtvnghncevrkal
Timeline for d1ha1a2: