Lineage for d1nlkl_ (1nlk L:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194494Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)
  8. 2194499Domain d1nlkl_: 1nlk L: [39146]
    complexed with adp, mg

Details for d1nlkl_

PDB Entry: 1nlk (more details), 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
PDB Compounds: (L:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nlkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

SCOPe Domain Coordinates for d1nlkl_:

Click to download the PDB-style file with coordinates for d1nlkl_.
(The format of our PDB-style files is described here.)

Timeline for d1nlkl_: