Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
Domain d6s98b_: 6s98 B: [391454] automated match to d1zdna1 complexed with act, edo, na |
PDB Entry: 6s98 (more details), 1.55 Å
SCOPe Domain Sequences for d6s98b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s98b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} enlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmkll lgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnp esalneeagrlllenyeeyaararllteihg
Timeline for d6s98b_: