Lineage for d6s67c_ (6s67 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940631Species Aequorea australis [TaxId:1246302] [391430] (2 PDB entries)
  8. 2940635Domain d6s67c_: 6s67 C: [391453]
    automated match to d2hpwa_
    complexed with cro, gol

Details for d6s67c_

PDB Entry: 6s67 (more details), 2.47 Å

PDB Description: structure of the fluorescent protein aausfp1 from aequorea cf. australis at ph 7.0
PDB Compounds: (C:) Aequorea cf. australis fluorescent protein 1 (AausFP1)

SCOPe Domain Sequences for d6s67c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s67c_ d.22.1.0 (C:) automated matches {Aequorea australis [TaxId: 1246302]}
lfrekipyvvemegdvegmkfsvrgkghgdantgkieasficttgelpvpwssilttvgy
gaqcfakypndikdypksampegyvqertitfendgvyktraevtyekgsvynrvtlngs
gfkkggnilgkklefnynphciyvlpdvqnngikcyinivhdvigggqiiaahqqlntpl
gggpvdiphyhhiqahtilskdpketrdhmnvvevfraidcktaya

SCOPe Domain Coordinates for d6s67c_:

Click to download the PDB-style file with coordinates for d6s67c_.
(The format of our PDB-style files is described here.)

Timeline for d6s67c_: