SCOP 1.61: Domain d1nlkr_: 1nlk R:

Lineage for d1nlkr_ (1nlk R:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)

8. Domain d1nlkr_: 1nlk R: [39145]

Details for d1nlkr_

PDB Entry: 1nlk, 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution

SCOP Domain Sequences for d1nlkr_:

Sequence; same for both SEQRES and ATOM records:

>d1nlkr_ d.58.6.1 (R:) Nucleoside diphosphate kinases {Myxococcus xanthus}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

Timeline for d1nlkr_:

• d1nlkr_ first appeared (with stable ids) in SCOP 1.55
  
• d1nlkr_ appears in SCOP 1.59
  
• d1nlkr_ appears in SCOP 1.63
  
• d1nlkr_ appears in the current release, SCOPe 2.08