Lineage for d2nckr_ (2nck R:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518282Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2518412Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)
  8. 2518416Domain d2nckr_: 2nck R: [39143]

Details for d2nckr_

PDB Entry: 2nck (more details), 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
PDB Compounds: (R:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2nckr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nckr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyqk

SCOPe Domain Coordinates for d2nckr_:

Click to download the PDB-style file with coordinates for d2nckr_.
(The format of our PDB-style files is described here.)

Timeline for d2nckr_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nckl_