Lineage for d5rg4a_ (5rg4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831376Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)
  8. 2831416Domain d5rg4a_: 5rg4 A: [391400]
    automated match to d1goka_
    complexed with act, so4

Details for d5rg4a_

PDB Entry: 5rg4 (more details), 1.99 Å

PDB Description: crystal structure of kemp eliminase hg3 in unbound state, 277k
PDB Compounds: (A:) Kemp Eliminase HG3

SCOPe Domain Sequences for d5rg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rg4a_ c.1.8.3 (A:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
qsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgmvwpensmkwdatepsqgnfnf
agadylvnwaqqngkligggmlvwhsqlpswvssitdkntltnvmknhittlmtrykgki
rawdvvgeafnedgslrqtvflnvigedyipiafqtaraadpnaklyimdynldsasypk
tqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevsilmldvaga
sptdyvnvvnaclnvqscvgitvfgvadpdswrasttpllfdgnfnpkpaynaivqdlqq

SCOPe Domain Coordinates for d5rg4a_:

Click to download the PDB-style file with coordinates for d5rg4a_.
(The format of our PDB-style files is described here.)

Timeline for d5rg4a_: