![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54926] (2 PDB entries) |
![]() | Domain d1ndlc_: 1ndl C: [39140] |
PDB Entry: 1ndl (more details), 2.4 Å
SCOPe Domain Sequences for d1ndlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndlc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs davesaekeialwfnekelvtwtpaakdwiye
Timeline for d1ndlc_: