SCOPe 2.07: Domain d6rijb1: 6rij B:176-309

Lineage for d6rijb1 (6rij B:176-309)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d6rijb1: 6rij B:176-309 [391384]
   Other proteins in same PDB: d6rija_, d6rijc_
   automated match to d1h1pb1
   complexed with gol, k4w, na

Details for d6rijb1

PDB Entry: 6rij, 2.2 Å

PDB Description: cdk2/cyclin a2 in complex with open-ring 5-nitrosopyrimidine inhibitor lc436

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6rijb1:

Sequence; same for both SEQRES and ATOM records:

>d6rijb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Timeline for d6rijb1:

• d6rijb1 is new in SCOPe 2.07-stable
  
• d6rijb1 appears in the current release, SCOPe 2.08