Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54926] (2 PDB entries) |
Domain d1ndla_: 1ndl A: [39138] |
PDB Entry: 1ndl (more details), 2.4 Å
SCOPe Domain Sequences for d1ndla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndla_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs davesaekeialwfnekelvtwtpaakdwiye
Timeline for d1ndla_: