Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein MAP kinase p38 [56129] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56131] (111 PDB entries) |
Domain d5r9pa_: 5r9p A: [391354] automated match to d1leza_ complexed with cl, dms, mg, sfy, so4 |
PDB Entry: 5r9p (more details), 1.72 Å
SCOPe Domain Sequences for d5r9pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r9pa_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]} rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
Timeline for d5r9pa_: