SCOPe 2.04: Domain d1nsqa_: 1nsq A:

Lineage for d1nsqa_ (1nsq A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54926] (2 PDB entries)

8. Domain d1nsqa_: 1nsq A: [39135]

Details for d1nsqa_

PDB Entry: 1nsq, 2.18 Å

PDB Description: mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nsqa_:

Sequence; same for both SEQRES and ATOM records:

>d1nsqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
davesaekeialwfnekelvtwtpaakdwiye

Timeline for d1nsqa_:

• d1nsqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsqa_ appears in SCOPe 2.03
  
• d1nsqa_ appears in SCOPe 2.05
  
• d1nsqa_ appears in the current release, SCOPe 2.08