Lineage for d1buxc_ (1bux C:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (8 species) Species Dictyostelium discoideum [TaxId:44689] [54925] (19 PDB entries) 
Domain d1buxc_: 1bux C: [39134]
complexed with pps
Details for d1buxc_
PDB Entry: 1bux (more details), 2.8 Å
PDB Description: 3'-phosphorylated nucleotides binding to nucleoside diphosphate kinase
SCOP Domain Sequences for d1buxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buxc_ d.58.6.1 (C:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye
SCOP Domain Coordinates for d1buxc_:
Click to download the PDB-style file with coordinates for d1buxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buxc_:
- d1buxc_ first appeared (with stable ids) in SCOP 1.55
- d1buxc_ appears in SCOP 1.61
- d1buxc_ appears in SCOP 1.65
- d1buxc_ appears in the current release, SCOPe 2.08
View in 3D
