Lineage for d5r9va_ (5r9v A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982128Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2982351Species Mouse (Mus musculus) [TaxId:10090] [56131] (111 PDB entries)
  8. 2982363Domain d5r9va_: 5r9v A: [391338]
    automated match to d1leza_
    complexed with cl, dms, mg, so4, ssy

Details for d5r9va_

PDB Entry: 5r9v (more details), 1.45 Å

PDB Description: pandda analysis group deposition form1 map kinase p38-alpha -- fragment n13596a in complex with map kinase p38-alpha
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d5r9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r9va_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d5r9va_:

Click to download the PDB-style file with coordinates for d5r9va_.
(The format of our PDB-style files is described here.)

Timeline for d5r9va_: