Lineage for d1buxb_ (1bux B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (6 species) Species Dictyostelium discoideum [TaxId:44689] [54925] (16 PDB entries) 
Domain d1buxb_: 1bux B: [39133]
Details for d1buxb_
PDB Entry: 1bux (more details), 2.8 Å
PDB Description: 3'-phosphorylated nucleotides binding to nucleoside diphosphate kinase
SCOP Domain Sequences for d1buxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buxb_ d.58.6.1 (B:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye
SCOP Domain Coordinates for d1buxb_:
Click to download the PDB-style file with coordinates for d1buxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buxb_:
- d1buxb_ appears in SCOP 1.57
- d1buxb_ appears in the current release, SCOPe 2.08
View in 3D
