SCOPe 2.06: Domain d1buxa_: 1bux A:

Lineage for d1buxa_ (1bux A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)

8. Domain d1buxa_: 1bux A: [39132]
   complexed with pps

Details for d1buxa_

PDB Entry: 1bux, 2.8 Å

PDB Description: 3'-phosphorylated nucleotides binding to nucleoside diphosphate kinase

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1buxa_:

Sequence; same for both SEQRES and ATOM records:

>d1buxa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1buxa_:

• d1buxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1buxa_ appears in SCOPe 2.05
  
• d1buxa_ appears in SCOPe 2.07
  
• d1buxa_ appears in the current release, SCOPe 2.08