Lineage for d1buxa_ (1bux A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (8 species) Species Dictyostelium discoideum [TaxId:44689] [54925] (18 PDB entries) 
Domain d1buxa_: 1bux A: [39132]
Details for d1buxa_
PDB Entry: 1bux (more details), 2.8 Å
PDB Description: 3'-phosphorylated nucleotides binding to nucleoside diphosphate kinase
SCOP Domain Sequences for d1buxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buxa_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye
SCOP Domain Coordinates for d1buxa_:
Click to download the PDB-style file with coordinates for d1buxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buxa_:
- d1buxa_ first appeared (with stable ids) in SCOP 1.55
- d1buxa_ appears in SCOP 1.59
- d1buxa_ appears in SCOP 1.63
- d1buxa_ appears in the current release, SCOPe 2.08
View in 3D
