Lineage for d1b99d_ (1b99 D:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (8 species) Species Dictyostelium discoideum [TaxId:44689] [54925] (18 PDB entries) 
Domain d1b99d_: 1b99 D: [39129]
Details for d1b99d_
PDB Entry: 1b99 (more details), 2.7 Å
PDB Description: 3'-fluoro-uridine diphosphate binding to nucleoside diphosphate kinase
SCOP Domain Sequences for d1b99d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b99d_ d.58.6.1 (D:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye
SCOP Domain Coordinates for d1b99d_:
Click to download the PDB-style file with coordinates for d1b99d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b99d_:
- d1b99d_ first appeared (with stable ids) in SCOP 1.55
- d1b99d_ appears in SCOP 1.59
- d1b99d_ appears in SCOP 1.63
- d1b99d_ appears in the current release, SCOPe 2.08
View in 3D
