Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) |
Protein Nucleoside diphosphate kinases [54921] (8 species) |
Species Dictyostelium discoideum [TaxId:44689] [54925] (19 PDB entries) |
Domain d1b99a_: 1b99 A: [39126] |
PDB Entry: 1b99 (more details), 2.7 Å
SCOP Domain Sequences for d1b99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b99a_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Dictyostelium discoideum} vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1b99a_: