Lineage for d6pwqa_ (6pwq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807401Family b.67.2.2: Levansucrase [101881] (2 proteins)
    automatically mapped to Pfam PF02435
  6. 2807428Protein automated matches [391214] (1 species)
    not a true protein
  7. 2807429Species Bacillus subtilis [TaxId:1423] [391215] (2 PDB entries)
  8. 2807432Domain d6pwqa_: 6pwq A: [391225]
    automated match to d1oyga_
    complexed with ca, gol, pg4, so4; mutant

Details for d6pwqa_

PDB Entry: 6pwq (more details), 2.6 Å

PDB Description: crystal structure of levansucrase from bacillus subtilis mutant s164a at 2.6 a
PDB Compounds: (A:) Glycoside hydrolase family 68 protein

SCOPe Domain Sequences for d6pwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pwqa_ b.67.2.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewagsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltv

SCOPe Domain Coordinates for d6pwqa_:

Click to download the PDB-style file with coordinates for d6pwqa_.
(The format of our PDB-style files is described here.)

Timeline for d6pwqa_: