Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:1257118] [391210] (2 PDB entries) |
Domain d6q2cb1: 6q2c B:43-486 [391211] Other proteins in same PDB: d6q2ca2, d6q2ca3, d6q2cb2, d6q2cb3 automated match to d3khma_ complexed with cl, hem, k, peg |
PDB Entry: 6q2c (more details), 1.8 Å
SCOPe Domain Sequences for d6q2cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q2cb1 a.104.1.0 (B:43-486) automated matches {Acanthamoeba castellanii [TaxId: 1257118]} lppvvsslipfvgsglsfaggplqyttdaykkygdiftmkvfgqrltflvgpdahvpffs qgdaelsqdepyqfsvpifgpnvvygadlahrnqqlkfiaaslstkalqsyvplivkeae dffakwdksgtvdirdalaeliiltasrclmgkeirenlftevaklyqtldegllpisvf fpylpipahkrrdearlamvrmfkkiiderranpevkhndclqvfmdaryrgeeqalnde eitglmiallfagqhtssvtgswtglllfeannkkkflpgvleeqeeirkefgdeltmea lnkmdklhrcvkealrmyppllfvmrkvikpfsykdyyvpegdtvfvspalsmrveevfp nadqynperfveedkqaqkyrfvgfgagrhgcmgenfaylqiktiwsvllrnfdielvge lpkpdytamvvgpahpcllrytrk
Timeline for d6q2cb1: