Lineage for d6ly5j_ (6ly5 j:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631564Species Chaetoceros gracilis [TaxId:184592] [391196] (1 PDB entry)
  8. 2631565Domain d6ly5j_: 6ly5 j: [391197]
    Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5c_, d6ly5d_, d6ly5e_, d6ly5f_
    automated match to d5l8rj_
    complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5j_

PDB Entry: 6ly5 (more details), 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex
PDB Compounds: (j:) PsaJ

SCOPe Domain Sequences for d6ly5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ly5j_ f.23.18.0 (j:) automated matches {Chaetoceros gracilis [TaxId: 184592]}
mrdlktylsvapvastlwfaalagllieinrlfpdaltfpf

SCOPe Domain Coordinates for d6ly5j_:

Click to download the PDB-style file with coordinates for d6ly5j_.
(The format of our PDB-style files is described here.)

Timeline for d6ly5j_: