![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
![]() | Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
![]() | Protein automated matches [276198] (4 species) not a true protein |
![]() | Species Chaetoceros gracilis [TaxId:184592] [391196] (1 PDB entry) |
![]() | Domain d6ly5j_: 6ly5 j: [391197] Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5c_, d6ly5d_, d6ly5e_, d6ly5f_ automated match to d5l8rj_ complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd |
PDB Entry: 6ly5 (more details), 2.38 Å
SCOPe Domain Sequences for d6ly5j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ly5j_ f.23.18.0 (j:) automated matches {Chaetoceros gracilis [TaxId: 184592]} mrdlktylsvapvastlwfaalagllieinrlfpdaltfpf
Timeline for d6ly5j_: