SCOP 1.71: Domain d1lwxa_: 1lwx A:

Lineage for d1lwxa_ (1lwx A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (21 PDB entries)

8. Domain d1lwxa_: 1lwx A: [39119]

Details for d1lwxa_

PDB Entry: 1lwx, 2.3 Å

PDB Description: azt diphosphate binding to nucleoside diphosphate kinase

SCOP Domain Sequences for d1lwxa_:

Sequence; same for both SEQRES and ATOM records:

>d1lwxa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgraiihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1lwxa_:

• d1lwxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1lwxa_ appears in SCOP 1.69
  
• d1lwxa_ appears in SCOP 1.73
  
• d1lwxa_ appears in the current release, SCOPe 2.08