SCOPe 2.08: Domain d6pxrl2: 6pxr L:113-218

Lineage for d6pxrl2 (6pxr L:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6pxrl2: 6pxr L:113-218 [391171]
   Other proteins in same PDB: d6pxrh_, d6pxrl1
   automated match to d1t66c2

Details for d6pxrl2

PDB Entry: 6pxr, 1.56 Å

PDB Description: anti-tau biib092 fab with tau peptide

PDB Compounds: (L:) gosuranemab Fab, light chain

SCOPe Domain Sequences for d6pxrl2:

Sequence; same for both SEQRES and ATOM records:

>d6pxrl2 b.1.1.2 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d6pxrl2:

• d6pxrl2 first appeared in SCOPe 2.07